PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g043764m
Common NameCISIN_1g043764mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 460aa    MW: 51457 Da    PI: 6.1502
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g043764mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS308.71.4e-94534552373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.....fsevs 88 
                        ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl+  f++AL +r a+  s+++k l++ ++++ n + + + +++     f++++
  orange1.1g043764m  53 EQLLVHCANAIESNDATLAQQILWVLNNIAPPDGDSNQRLTCAFLRALITRAAK--SGTCKMLAAMANAHCNLVVHNHKFSVielasFVDLT 142
                        79****************************************************..8888888888887777444444443334488***** PP

               GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfe 177
                        P+++f++ +aN aIleav+g++ vHi+D+++++++Q p+L++a+a+R egpp+l++T+ g+ e +      ++ee+g +L +fA++ +v +e
  orange1.1g043764m 143 PWHRFGFTAANAAILEAVDGCSVVHIVDLSLTHCMQIPTLIDAIANRFEGPPRLKLTVAGATEDVppmLDLSYEELGTKLVNFARSRNVMLE 234
                        *************************************************************887798888999******************* PP

               GRAS 178 fnvl.......vakrledleleeLrvkp.gEalaVnlvlqlhrll....................desvsleserdevLklvkslsPkvvvv 241
                        f+v+        a+ +e++++++L   + gEal++n++++lh+++                     +s+s++  r+ +Lk+++sl+P++vv+
  orange1.1g043764m 235 FRVIpssyadgFASLIEQMRVQQLVYAEsGEALVINCHMMLHYIPeetlnpsttfsslnpysleyYSSTSIS-LRSMFLKAIRSLEPTIVVL 325
                        ****9997766666777778888877779**********************************964444444.488**************** PP

               GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                        v+++ad+++++++ r+ +a++y +  +d +++ lpr s++r ++E++ + ++++nv+a+eg +r+er e +++W +r+++a F+ ++++e+a
  orange1.1g043764m 326 VDEDADLTANNLVCRLRSAFNYLWIPYDLVDTFLPRGSKQREWYEAA-VCWKVENVIAHEGLQRVERLEPKSRWVQRMRNANFRGITFGEEA 416
                        ***********************************************.99****************************************** PP

               GRAS 334 akqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                        +++ k++l +++  g+ +++e++ lvl+Wk+++ v++SaW
  orange1.1g043764m 417 VSELKTMLDEHA-AGWGLKKEEDDLVLTWKGHNAVFASAW 455
                        ************.8999*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.84726437IPR005202Transcription factor GRAS
PfamPF035144.7E-9253455IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MMQFTETPPP PLHQISSFSN FTMNKNQIHR TRPWPGFPSS KSFASFGDAN CMEQLLVHCA  60
NAIESNDATL AQQILWVLNN IAPPDGDSNQ RLTCAFLRAL ITRAAKSGTC KMLAAMANAH  120
CNLVVHNHKF SVIELASFVD LTPWHRFGFT AANAAILEAV DGCSVVHIVD LSLTHCMQIP  180
TLIDAIANRF EGPPRLKLTV AGATEDVPPM LDLSYEELGT KLVNFARSRN VMLEFRVIPS  240
SYADGFASLI EQMRVQQLVY AESGEALVIN CHMMLHYIPE ETLNPSTTFS SLNPYSLEYY  300
SSTSISLRSM FLKAIRSLEP TIVVLVDEDA DLTANNLVCR LRSAFNYLWI PYDLVDTFLP  360
RGSKQREWYE AAVCWKVENV IAHEGLQRVE RLEPKSRWVQ RMRNANFRGI TFGEEAVSEL  420
KTMLDEHAAG WGLKKEEDDL VLTWKGHNAV FASAWVPAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-15544556374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426063.10.0hypothetical protein CICLE_v10025567mg
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A067GH430.0A0A067GH43_CITSI; Uncharacterized protein
TrEMBLV4RWS10.0V4RWS1_9R
STRINGVIT_07s0129g00340.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54452750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein